Uploaded image for project: 'Jalview'
  1. Jalview
  2. JAL-282

sequences with very long ID strings and/or lots of reference

    XMLWordPrintable

    Details

    • Type: Bug
    • Status: In Progress
    • Priority: Minor
    • Resolution: Unresolved
    • Affects Version/s: None
    • Fix Version/s: None
    • Component/s: gui design issue
    • Labels:

      Description

      The tooltips displayed for these sequences are huge (when displaying uniprot retrieved DBRefs), and get in the way of the menu (occasionally - most problem is on small screens).

      Additionally, the horizontal alignment slider bar for the display is very narrow because of the wide sequence ID panel. A better solution would be to have a slider bar on the sequence ID panel as well (when IDs are wider than the panel width).


      ****** ADDITIONAL INFORMATION ******

      >UniProt/Swiss-Prot|P63211|O43835|Q08447|Q16026|GBG1_HUMAN/1-74 Guanine nucleotide-binding protein G(T) gamma-T1 subunit precursor
      MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCV
      IS
      >UniProt/Swiss-Prot|P49758|O75576|O75577|Q8TE13|Q8TE14|Q8TE15|Q8TE16|Q8TE17|Q8TE18|Q8TE19|Q8TE20|Q8TE21|Q8TE22|Q9Y245|Q9Y647|RGS6_HUMAN/1-567 Regulator of G-protein signaling 6
      MAQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKN
      LSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDGTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKA
      RLELADYEAENLARLQRAFAKKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCLNTTEMD
      IRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIA
      YTEQYVEYDPLITPAEPSNPWISEEVALWDIEMSKDPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSS
      ENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKL
      MKSDSYARFPPVKCLPGFAAGQEEGKVAGGQAPHGPDAVPPEPSSPQSRAWARGPHRQAAALHICGQSFLTR
      RLGHCEGERVRAMKGDGGETRWVNGQTRKKESTEPGLGPVEAPVYSPLFFVQLYSNTPLAKRP

        Attachments

          Issue Links

            Activity

              People

              Assignee:
              jprocter Jim Procter
              Reporter:
              jprocter Jim Procter
              Votes:
              0 Vote for this issue
              Watchers:
              2 Start watching this issue

                Dates

                Created:
                Updated: